PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_18002g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 836aa    MW: 91865.6 Da    PI: 6.8457
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_18002g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.64.9e-095105471954
                    HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
       Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                    Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  MA_18002g0010 510 FEHflHPYPKDADKHLLARQTGLTRSQVSNWFINARVR 547
                    564459******************************88 PP

2BELL122.71.5e-39373444172
           BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                    +rqelq+kkakL+ +l+eVd+rY+qy++q+++v+ssFea+ag g+ak YtslAlk+iSrhFr+L+daia+qi
  MA_18002g0010 373 DRQELQMKKAKLVAMLDEVDRRYRQYYHQMHIVVSSFEAAAGFGAAKTYTSLALKTISRHFRSLRDAIAGQI 444
                    699********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.4E-59285442IPR006563POX domain
PfamPF075268.5E-48291441IPR006563POX domain
PROSITE profilePS5007111.969488551IPR001356Homeobox domain
CDDcd000861.84E-12491552No hitNo description
SMARTSM003896.2E-9491555IPR001356Homeobox domain
SuperFamilySSF466897.27E-17492558IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28494558IPR009057Homeodomain-like
PfamPF059201.8E-17508547IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 836 aa     Download sequence    Send to blast
MATYFPGSNI QPDTMQTLYL MNPDYTGYAD MQTPGNMVLI NQSTGTPSAN SHLAGSGQPQ  60
QHFIGIPFPS APHPQRYSMA SVESSGGTQQ DVTSTLLSSR LGNHGYNVWR NVGNELTFMQ  120
PTDPTPHNNQ SLSGQLNNFS NLGHQSVSEI SPTGMKRATM SSIPEQQLGM NPNGLGLQLD  180
QSHGLAAHGR GLSLSLSPQQ LSNIQLSCFQ NQPTDSEVNC PTISEATSQE NMNRADRLTS  240
KLSGSLSSFR ASSRDGMLGT KFLGTVNGSE CNKQMHHGTN AIGAAELSNS LTGSKYFKAA  300
QQLLDEVVNV GKGIKSDSVN HQKSQTWFGT ISDKKNIGTE ATTNDRTTSA ITGPSISAQE  360
MKNEHAFGLT PADRQELQMK KAKLVAMLDE VDRRYRQYYH QMHIVVSSFE AAAGFGAAKT  420
YTSLALKTIS RHFRSLRDAI AGQIRLTSKN LGEEDLTGSG KGETSRLHFV DQQLRQQRAL  480
QQLGMIQQHA WRPQRGLPER AVSILRAWLF EHFLHPYPKD ADKHLLARQT GLTRSQVSNW  540
FINARVRLWK PMVEEMYMEE LREADTQNRA ADSKVTTESG QNNEETVSKE GPGNSENGQE  600
EKSKKNRTLN NSIEEGGYMQ QNGGFKPDQA SDRINGRNQT TGMTGVSDSH VFHEIDNEDP  660
RQGQQKKVRN GIQDSTILLP PNMGMDVDLK SEETGSEYIL DTSKFASDEK HASEGYSFAN  720
NKMVRLDDSG SFGSYQLGGL SRYGQETFTP KYSGIGGVSL TLGLQHCDDL SLSGTQQSYN  780
SSQGLGSGRR HDLGSDSDDY CHIHDTSAVR GASTYDNMSM QNGKRFATHM LHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16497554158Homeobox protein Meis1
4xrs_B1e-16497554158Homeobox protein Meis1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1176760.0BT117676.1 Picea glauca clone GQ03907_E01 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9RM180.0A0A0C9RM18_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_11489_4138 transcribed RNA sequence
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.33e-99BEL1-like homeodomain 1